Anti-SNRNP48

Artikelnummer: ATA-HPA029234
Artikelname: Anti-SNRNP48
Artikelnummer: ATA-HPA029234
Hersteller Artikelnummer: HPA029234
Alternativnummer: ATA-HPA029234-100,ATA-HPA029234-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C6orf151, dJ336K20B.1, dJ512B11.2, FLJ32234
small nuclear ribonucleoprotein 48kDa (U11/U12)
Anti-SNRNP48
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 154007
UniProt: Q6IEG0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SNRNP48
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and SNRNP48 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407462).
HPA029234-100ul
HPA029234-100ul
HPA029234-100ul