Anti-COL6A1
Artikelnummer:
ATA-HPA029401
- Bilder (8)
| Artikelname: | Anti-COL6A1 |
| Artikelnummer: | ATA-HPA029401 |
| Hersteller Artikelnummer: | HPA029401 |
| Alternativnummer: | ATA-HPA029401-100,ATA-HPA029401-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COL6A1 |
| collagen, type VI, alpha 1 |
| Anti-COL6A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1291 |
| UniProt: | P12109 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIKNNVEQVCCSFECQPAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COL6A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA029401 antibody. Corresponding COL6A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows weak positivity in extracellular matrix in peritubular myoid cells. |
|
|
Immunohistochemical staining of human skin shows moderate positivity in extracellular matrix. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in extracellular matrix. |
|
|
HPA029401-100ul |
|
|
HPA029401-100ul |
|
|
HPA029401-100ul |
Produktgarantie und fachkundiger Support
