Anti-KLHL7
Artikelnummer:
ATA-HPA029491
- Bilder (9)
| Artikelname: | Anti-KLHL7 |
| Artikelnummer: | ATA-HPA029491 |
| Hersteller Artikelnummer: | HPA029491 |
| Alternativnummer: | ATA-HPA029491-100,ATA-HPA029491-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KLHL6, RP42, SBBI26 |
| kelch-like family member 7 |
| Anti-KLHL7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55975 |
| UniProt: | Q8IXQ5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KLHL7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human heart muscle shows moderate membranous positivity in intercalated discs. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
|
|
|
|
|
|
HPA029491-100ul |
|
|
HPA029491-100ul |
|
|
HPA029491-100ul |
Produktgarantie und fachkundiger Support
