Anti-SNAP91
Artikelnummer:
ATA-HPA029632
- Bilder (8)
| Artikelname: | Anti-SNAP91 |
| Artikelnummer: | ATA-HPA029632 |
| Hersteller Artikelnummer: | HPA029632 |
| Alternativnummer: | ATA-HPA029632-100,ATA-HPA029632-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AP180, CALM, KIAA0656 |
| synaptosomal-associated protein, 91kDa |
| Anti-SNAP91 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9892 |
| UniProt: | O60641 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LMETLEQHLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SNAP91 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-SNAP91 antibody HPA029632 (A) shows similar protein distribution across tissues to independent antibody HPA029633 (B). |
|
|
Immunohistochemical staining of human liver using Anti-SNAP91 antibody HPA029632. |
|
|
Immunohistochemical staining of human colon using Anti-SNAP91 antibody HPA029632. |
|
|
Immunohistochemical staining of human lymph node using Anti-SNAP91 antibody HPA029632. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SNAP91 antibody HPA029632. |
|
|
HPA029632-100ul |
|
|
HPA029632-100ul |
|
|
HPA029632-100ul |
Produktgarantie und fachkundiger Support
