Anti-LMOD1
Artikelnummer:
ATA-HPA030097
- Bilder (9)
| Artikelname: | Anti-LMOD1 |
| Artikelnummer: | ATA-HPA030097 |
| Hersteller Artikelnummer: | HPA030097 |
| Alternativnummer: | ATA-HPA030097-100,ATA-HPA030097-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 1D, 64kD, D1 |
| leiomodin 1 (smooth muscle) |
| Anti-LMOD1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 25802 |
| UniProt: | P29536 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQMPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LMOD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human prostate and liver tissues using Anti-LMOD1 antibody. Corresponding LMOD1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, prostate and smooth muscle using Anti-LMOD1 antibody HPA030097 (A) shows similar protein distribution across tissues to independent antibody HPA028325 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human smooth muscle using Anti-LMOD1 antibody HPA030097. |
|
|
Immunohistochemical staining of human colon using Anti-LMOD1 antibody HPA030097. |
|
|
HPA030097-100ul |
|
|
HPA030097-100ul |
|
|
HPA030097-100ul |
Produktgarantie und fachkundiger Support
