Anti-INSL5
Artikelnummer:
ATA-HPA030100
- Bilder (8)
| Artikelname: | Anti-INSL5 |
| Artikelnummer: | ATA-HPA030100 |
| Hersteller Artikelnummer: | HPA030100 |
| Alternativnummer: | ATA-HPA030100-100,ATA-HPA030100-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | INSL5 |
| insulin-like 5 |
| Anti-INSL5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10022 |
| UniProt: | Q9Y5Q6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | INSL5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human rectum and liver tissues using Anti-INSL5 antibody. Corresponding INSL5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and INSL5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417280). |
|
|
HPA030100 |
|
|
|
|
|
HPA030100 |
|
|
HPA030100 |
Produktgarantie und fachkundiger Support
