Anti-PDXK
Artikelnummer:
ATA-HPA030197
- Bilder (7)
| Artikelname: | Anti-PDXK |
| Artikelnummer: | ATA-HPA030197 |
| Hersteller Artikelnummer: | HPA030197 |
| Alternativnummer: | ATA-HPA030197-100,ATA-HPA030197-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C21orf124, C21orf97, FLJ21324, FLJ31940, MGC15873, PKH, PNK, PRED79 |
| pyridoxal (pyridoxine, vitamin B6) kinase |
Anti-PDXK |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8566 |
| UniProt: | O00764 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PDXK |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human gall bladder shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis using Anti-PDXK antibody HPA030197 (A) shows similar pattern to independent antibody HPA030196 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA030197-100ul |
|
|
HPA030197-100ul |
|
|
HPA030197-100ul |
Produktgarantie und fachkundiger Support
