Anti-AGPS
Artikelnummer:
ATA-HPA030211
- Bilder (9)
| Artikelname: | Anti-AGPS |
| Artikelnummer: | ATA-HPA030211 |
| Hersteller Artikelnummer: | HPA030211 |
| Alternativnummer: | ATA-HPA030211-100,ATA-HPA030211-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ADAP-S, ADAS, ADHAPS, ADPS, ALDHPSY |
| alkylglycerone phosphate synthase |
| Anti-AGPS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8540 |
| UniProt: | O00116 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AGPS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & peroxisomes. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in subsets of islet cells. |
|
|
Western blot analysis using Anti-AGPS antibody HPA030211 (A) shows similar pattern to independent antibody HPA030210 (B). |
|
|
Western blot analysis in human cell line U-2 OS. |
|
|
HPA030211-100ul |
|
|
|
|
|
|
|
|
HPA030211-100ul |
|
|
HPA030211-100ul |
Produktgarantie und fachkundiger Support
