Anti-AFDN
Artikelnummer:
ATA-HPA030213
- Bilder (8)
| Artikelname: | Anti-AFDN |
| Artikelnummer: | ATA-HPA030213 |
| Hersteller Artikelnummer: | HPA030213 |
| Alternativnummer: | ATA-HPA030213-100,ATA-HPA030213-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AF-6, AF6, MLLT4 |
| afadin, adherens junction formation factor |
| Anti-AFDN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4301 |
| UniProt: | P55196 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AFDN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles, plasma membrane & cell junctions. |
|
|
Immunohistochemical staining of human epididymis shows strong membranous positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Esophagus tissue |
|
|
|
|
|
HPA030213 |
|
|
|
|
|
HPA030213 |
|
|
HPA030213 |
Produktgarantie und fachkundiger Support
