Anti-PSMB10
Artikelnummer:
ATA-HPA030224
- Bilder (8)
| Artikelname: | Anti-PSMB10 |
| Artikelnummer: | ATA-HPA030224 |
| Hersteller Artikelnummer: | HPA030224 |
| Alternativnummer: | ATA-HPA030224-100,ATA-HPA030224-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | beta2i, LMP10, MECL1, MGC1665 |
| proteasome (prosome, macropain) subunit, beta type, 10 |
| Anti-PSMB10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5699 |
| UniProt: | P40306 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMB10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to cytosol. |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-PSMB10 antibody. Corresponding PSMB10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
HPA030224-100ul |
|
|
|
|
|
HPA030224-100ul |
|
|
HPA030224-100ul |
Produktgarantie und fachkundiger Support
