Anti-NCOA7

Artikelnummer: ATA-HPA030292
Artikelname: Anti-NCOA7
Artikelnummer: ATA-HPA030292
Hersteller Artikelnummer: HPA030292
Alternativnummer: ATA-HPA030292-100,ATA-HPA030292-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: dJ187J11.3, ERAP140, TLDC4
nuclear receptor coactivator 7
Anti-NCOA7
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 135112
UniProt: Q8NI08
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EPLPVKLNSSTEANVIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCIKVGKPMRKSFATHTAAMVQQYGKRR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NCOA7
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA030292-100ul
HPA030292-100ul
HPA030292-100ul