Anti-DEAF1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030302
Artikelname: Anti-DEAF1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030302
Hersteller Artikelnummer: HPA030302
Alternativnummer: ATA-HPA030302-100,ATA-HPA030302-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NUDR, SPN, ZMYND5
DEAF1 transcription factor
Anti-DEAF1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10522
UniProt: O75398
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DEAF1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Liver tissue
HPA030302
HPA030302
HPA030302