Anti-PCNA

Artikelnummer: ATA-HPA030522
Artikelname: Anti-PCNA
Artikelnummer: ATA-HPA030522
Hersteller Artikelnummer: HPA030522
Alternativnummer: ATA-HPA030522-100,ATA-HPA030522-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
proliferating cell nuclear antigen
Anti-PCNA
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5111
UniProt: P12004
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PCNA
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.
Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using HPA030522 antibody. Corresponding PCNA RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow, kidney, lymph node and testis using Anti-PCNA antibody HPA030522 (A) shows similar protein distribution across tissues to independent antibody HPA030521 (B).
Immunohistochemical staining of human liver shows moderate to strong nuclear positivity in hepatocytes.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
Immunohistochemical staining of human skeletal muscle shows very weak nuclear positivity in myocytes.
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human kidney using Anti-PCNA antibody HPA030522.
Immunohistochemical staining of human bone marrow using Anti-PCNA antibody HPA030522.
Immunohistochemical staining of human testis using Anti-PCNA antibody HPA030522.
Immunohistochemical staining of human lymph node using Anti-PCNA antibody HPA030522.
Western blot analysis using Anti-PCNA antibody HPA030522 (A) shows similar pattern to independent antibody HPA030521 (B).
Western blot analysis in human cell line MOLT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA030522-100ul
HPA030522-100ul
HPA030522-100ul