Anti-LPIN2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030550
Artikelname: Anti-LPIN2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030550
Hersteller Artikelnummer: HPA030550
Alternativnummer: ATA-HPA030550-100,ATA-HPA030550-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0249
lipin 2
Anti-LPIN2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 9663
UniProt: Q92539
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LATSPIPTEDQFFKDIDTPLVKSGGDETPSQSSDISHVLETETIFTPSSVKKKKRRRKKYKQDSKKEEQAASAAAEDTCDVGVSSDDDKGAQAARGSSNASLKEEECKEPLLFHSGDHYPLSDGDWSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LPIN2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & actin filaments.
Immunohistochemistry analysis in human duodenum and skeletal muscle tissues using Anti-LPIN2 antibody. Corresponding LPIN2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA030550
HPA030550
HPA030550