Anti-C6orf62 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030564
Artikelname: Anti-C6orf62 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030564
Hersteller Artikelnummer: HPA030564
Alternativnummer: ATA-HPA030564-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZP564G182, FLJ12619, XTP12
chromosome 6 open reading frame 62
Anti-C6orf62
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 81688
UniProt: Q9GZU0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: C6orf62
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-C6orf62 antibody. Corresponding C6orf62 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and C6orf62 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410655).
HPA030564
HPA030564
HPA030564