Anti-AIFM1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030611
Artikelname: Anti-AIFM1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030611
Hersteller Artikelnummer: HPA030611
Alternativnummer: ATA-HPA030611-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AIF, CMTX4, NAMSD, PDCD8
apoptosis-inducing factor, mitochondrion-associated, 1
Anti-AIFM1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 9131
UniProt: O95831
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AIFM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and cerebral cortex tissues using Anti-AIFM1 antibody. Corresponding AIFM1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA030611
HPA030611
HPA030611