Anti-OGT
Artikelnummer:
ATA-HPA030751
- Bilder (7)
| Artikelname: | Anti-OGT |
| Artikelnummer: | ATA-HPA030751 |
| Hersteller Artikelnummer: | HPA030751 |
| Alternativnummer: | ATA-HPA030751-100,ATA-HPA030751-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ23071, HRNT1, MGC22921, O-GLCNAC |
| O-linked N-acetylglucosamine (GlcNAc) transferase |
| Anti-OGT |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8473 |
| UniProt: | O15294 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | OGT |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis using Anti-OGT antibody HPA030751 (A) shows similar pattern to independent antibody HPA030753 (B). |
|
|
Western blot analysis in human cell line HeLa. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA030751-100ul |
|
|
HPA030751-100ul |
|
|
HPA030751-100ul |
Produktgarantie und fachkundiger Support
