Anti-RBFOX3

Artikelnummer: ATA-HPA030790
Artikelname: Anti-RBFOX3
Artikelnummer: ATA-HPA030790
Hersteller Artikelnummer: HPA030790
Alternativnummer: ATA-HPA030790-100,ATA-HPA030790-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FOX-3, HRNBP3, NeuN
RNA binding protein, fox-1 homolog (C. elegans) 3
Anti-RBFOX3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 146713
UniProt: A6NFN3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RBFOX3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-RBFOX3 antibody. Corresponding RBFOX3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA030790
HPA030790
HPA030790