Anti-IRF2
Artikelnummer:
ATA-HPA030813
- Bilder (9)
| Artikelname: | Anti-IRF2 |
| Artikelnummer: | ATA-HPA030813 |
| Hersteller Artikelnummer: | HPA030813 |
| Alternativnummer: | ATA-HPA030813-100,ATA-HPA030813-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IRF2 |
| interferon regulatory factor 2 |
| Anti-IRF2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3660 |
| UniProt: | P14316 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IRF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows moderate nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong nuclear positivity in a subset of myocytes. |
|
|
HPA030813-100ul |
|
|
|
|
|
HPA030813-100ul |
|
|
HPA030813-100ul |
Produktgarantie und fachkundiger Support
