Anti-ADAM12
Artikelnummer:
ATA-HPA030866
- Bilder (7)
| Artikelname: | Anti-ADAM12 |
| Artikelnummer: | ATA-HPA030866 |
| Hersteller Artikelnummer: | HPA030866 |
| Alternativnummer: | ATA-HPA030866-100,ATA-HPA030866-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MCMPMltna, MLTN |
| ADAM metallopeptidase domain 12 |
| Anti-ADAM12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8038 |
| UniProt: | O43184 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RGVSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ADAM12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA030866 antibody. Corresponding ADAM12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human smooth muscles shows moderate positivity. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA030866-100ul |
|
|
HPA030866-100ul |
|
|
HPA030866-100ul |
Produktgarantie und fachkundiger Support
