Anti-ADAM12

Artikelnummer: ATA-HPA030867
Artikelname: Anti-ADAM12
Artikelnummer: ATA-HPA030867
Hersteller Artikelnummer: HPA030867
Alternativnummer: ATA-HPA030867-100,ATA-HPA030867-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MCMPMltna, MLTN
ADAM metallopeptidase domain 12
Anti-ADAM12
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 8038
UniProt: O43184
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADAM12
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA030867 antibody. Corresponding ADAM12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate positivity in trophoblastic cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
HPA030867
HPA030867
HPA030867