Anti-ADAMTS5

Artikelnummer: ATA-HPA030906
Artikelname: Anti-ADAMTS5
Artikelnummer: ATA-HPA030906
Hersteller Artikelnummer: HPA030906
Alternativnummer: ATA-HPA030906-100,ATA-HPA030906-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ADAMTS11, ADMP-2
ADAM metallopeptidase with thrombospondin type 1 motif, 5
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 11096
UniProt: Q9UNA0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
Target-Kategorie: ADAMTS5
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
HPA030906-100ul