Anti-RECQL Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA030960
Artikelname: Anti-RECQL Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA030960
Hersteller Artikelnummer: HPA030960
Alternativnummer: ATA-HPA030960-100,ATA-HPA030960-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RecQ1, RecQL1
RecQ helicase-like
Anti-RECQL
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5965
UniProt: P46063
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RECQL
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry analysis in human lymph node and pancreas tissues using Anti-RECQL antibody. Corresponding RECQL RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA030960
HPA030960
HPA030960