Anti-ALB Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA031025
- Bilder (8)
| Artikelname: | Anti-ALB Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA031025 |
| Hersteller Artikelnummer: | HPA031025 |
| Alternativnummer: | ATA-HPA031025-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALB |
| albumin |
| Anti-ALB |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 213 |
| UniProt: | P02768 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ALB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum & the Golgi apparatus. |
|
|
Immunohistochemical staining of human ovary shows distinct extracellular positivity. |
|
|
Western blot analysis using Anti-ALB antibody HPA031025 (A) shows similar pattern to independent antibody HPA031024 (B). |
|
|
HPA031025 |
|
|
|
|
|
|
|
|
HPA031025 |
|
|
HPA031025 |
Produktgarantie und fachkundiger Support
