Anti-AOC1

Artikelnummer: ATA-HPA031033
Artikelname: Anti-AOC1
Artikelnummer: ATA-HPA031033
Hersteller Artikelnummer: HPA031033
Alternativnummer: ATA-HPA031033-100,ATA-HPA031033-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ABP1, DAO
amine oxidase, copper containing 1
Anti-AOC1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 26
UniProt: P19801
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AOC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in tubules.
Immunohistochemical staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human stomach shows moderate to strong membranous positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA031033
HPA031033
HPA031033