Anti-KCNJ8
Artikelnummer:
ATA-HPA031066
| Artikelname: |
Anti-KCNJ8 |
| Artikelnummer: |
ATA-HPA031066 |
| Hersteller Artikelnummer: |
HPA031066 |
| Alternativnummer: |
ATA-HPA031066-100,ATA-HPA031066-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Kir6.1 |
| potassium inwardly-rectifying channel, subfamily J, member 8 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
3764 |
| UniProt: |
Q15842 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
KRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNT |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
KCNJ8 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
Immunohistochemical staining of human testis shows very weak cytoplasmic positivity in cells in seminiferous ducts. |
|
Immunohistochemical staining of human heart muscle shows weak to moderate cytoplasmic positivity in cardiomyocytes. |
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
HPA031066-100ul |
|
|
|
HPA031066-100ul |
|
HPA031066-100ul |