Anti-DNAJC10

Artikelnummer: ATA-HPA031111
Artikelname: Anti-DNAJC10
Artikelnummer: ATA-HPA031111
Hersteller Artikelnummer: HPA031111
Alternativnummer: ATA-HPA031111-100,ATA-HPA031111-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ERdj5, PDIA19
DnaJ (Hsp40) homolog, subfamily C, member 10
Anti-DNAJC10
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 54431
UniProt: Q8IXB1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LNSLDAKEIYLEVIHNLPDFELLSANTLEDRLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC10
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
HPA031111-100ul