Anti-RSPH4A
Artikelnummer:
ATA-HPA031196
- Bilder (8)
| Artikelname: | Anti-RSPH4A |
| Artikelnummer: | ATA-HPA031196 |
| Hersteller Artikelnummer: | HPA031196 |
| Alternativnummer: | ATA-HPA031196-100,ATA-HPA031196-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B |
| radial spoke head 4 homolog A (Chlamydomonas) |
| Anti-RSPH4A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 345895 |
| UniProt: | Q5TD94 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RSPH4A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus. |
|
|
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-RSPH4A antibody. Corresponding RSPH4A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA031196 |
|
|
|
|
|
HPA031196 |
|
|
HPA031196 |
Produktgarantie und fachkundiger Support
