Anti-RSPH4A

Artikelnummer: ATA-HPA031196
Artikelname: Anti-RSPH4A
Artikelnummer: ATA-HPA031196
Hersteller Artikelnummer: HPA031196
Alternativnummer: ATA-HPA031196-100,ATA-HPA031196-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
radial spoke head 4 homolog A (Chlamydomonas)
Anti-RSPH4A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 345895
UniProt: Q5TD94
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RSPH4A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-RSPH4A antibody. Corresponding RSPH4A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA031196
HPA031196
HPA031196