Anti-TSPYL5

Artikelnummer: ATA-HPA031347
Artikelname: Anti-TSPYL5
Artikelnummer: ATA-HPA031347
Hersteller Artikelnummer: HPA031347
Alternativnummer: ATA-HPA031347-100,ATA-HPA031347-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1750
TSPY-like 5
Anti-TSPYL5
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 85453
UniProt: Q86VY4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSFFGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TSPYL5
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:5000 - 1:10000
Immunofluorescent staining of human cell line A549 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry analysis in human testis and placenta tissues using Anti-TSPYL5 antibody. Corresponding TSPYL5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human placenta shows low expression as expected.
HPA031347-100ul
HPA031347-100ul
HPA031347-100ul