Anti-SSTR1
Artikelnummer:
ATA-HPA031506
- Bilder (7)
| Artikelname: | Anti-SSTR1 |
| Artikelnummer: | ATA-HPA031506 |
| Hersteller Artikelnummer: | HPA031506 |
| Alternativnummer: | ATA-HPA031506-100,ATA-HPA031506-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SSTR1 |
| somatostatin receptor 1 |
| Anti-SSTR1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6751 |
| UniProt: | P30872 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SSTR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human stomach shows moderate to strong positivity in luminal membrane in glandular cells. |
|
|
Immunohistochemical staining of human upper gastrointestinal shows moderate to strong positivity in luminal membrane in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong positivity in apical membrane in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non - germinal center cells as expected. |
|
|
HPA031506-100ul |
|
|
HPA031506-100ul |
|
|
HPA031506-100ul |
Produktgarantie und fachkundiger Support
