Anti-MTX2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031550
Artikelname: Anti-MTX2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031550
Hersteller Artikelnummer: HPA031550
Alternativnummer: ATA-HPA031550-100,ATA-HPA031550-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MTX2
metaxin 2
Anti-MTX2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10651
UniProt: O75431
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MTX2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & mitochondria.
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA031550
HPA031550
HPA031550