Anti-KCTD8 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031562
Artikelname: Anti-KCTD8 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031562
Hersteller Artikelnummer: HPA031562
Alternativnummer: ATA-HPA031562-100,ATA-HPA031562-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KCTD8
potassium channel tetramerization domain containing 8
Anti-KCTD8
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 386617
UniProt: Q6ZWB6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KCTD8
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-KCTD8 antibody. Corresponding KCTD8 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA031562
HPA031562
HPA031562