Anti-MYLK Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031677
Artikelname: Anti-MYLK Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031677
Hersteller Artikelnummer: HPA031677
Alternativnummer: ATA-HPA031677-100,ATA-HPA031677-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MLCK, MLCK1, MYLK1, smMLCK
myosin light chain kinase
Anti-MYLK
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 4638
UniProt: Q15746
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MYLK
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human smooth muscle and skeletal muscle tissues using Anti-MYLK antibody. Corresponding MYLK RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human smooth muscle shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HEL
HPA031677
HPA031677
HPA031677