Anti-MB21D1
Artikelnummer:
ATA-HPA031700
- Bilder (7)
| Artikelname: | Anti-MB21D1 |
| Artikelnummer: | ATA-HPA031700 |
| Hersteller Artikelnummer: | HPA031700 |
| Alternativnummer: | ATA-HPA031700-100,ATA-HPA031700-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C6orf150 |
| Mab-21 domain containing 1 |
| Anti-MB21D1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 115004 |
| UniProt: | Q8N884 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MB21D1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in Hofbauer cells and placental trophoblast. |
|
|
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells in lamina propria. |
|
|
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages and a subset of leukocytes. |
|
|
Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MB21D1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
|
|
|
HPA031700-100ul |
Produktgarantie und fachkundiger Support
