Anti-TAF8

Artikelnummer: ATA-HPA031730
Artikelname: Anti-TAF8
Artikelnummer: ATA-HPA031730
Hersteller Artikelnummer: HPA031730
Alternativnummer: ATA-HPA031730-100,ATA-HPA031730-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ32821, TAF(II)43, TBN
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Anti-TAF8
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 129685
UniProt: Q7Z7C8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TAF8
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and TAF8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408568).
HPA031730-100ul
HPA031730-100ul
HPA031730-100ul