Anti-UPK1B
Artikelnummer:
ATA-HPA031799
- Bilder (7)
| Artikelname: | Anti-UPK1B |
| Artikelnummer: | ATA-HPA031799 |
| Hersteller Artikelnummer: | HPA031799 |
| Alternativnummer: | ATA-HPA031799-100,ATA-HPA031799-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TSPAN20, UPK1 |
| uroplakin 1B |
| Anti-UPK1B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7348 |
| UniProt: | O75841 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UPK1B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human urinary bladder and liver tissues using Anti-UPK1B antibody. Corresponding UPK1B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human urinary bladder shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and LY416300 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416300). |
|
|
HPA031799-100ul |
|
|
HPA031799-100ul |
|
|
HPA031799-100ul |
Produktgarantie und fachkundiger Support
