Anti-PLEK Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031838
Artikelname: Anti-PLEK Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031838
Hersteller Artikelnummer: HPA031838
Alternativnummer: ATA-HPA031838-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: P47
pleckstrin
Anti-PLEK
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5341
UniProt: P08567
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLEK
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and pancreas tissues using Anti-PLEK antibody. Corresponding PLEK RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and PLEK over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419171).
HPA031838
HPA031838
HPA031838