Anti-C2orf42 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031841
Artikelname: Anti-C2orf42 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031841
Hersteller Artikelnummer: HPA031841
Alternativnummer: ATA-HPA031841-100,ATA-HPA031841-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ20558
chromosome 2 open reading frame 42
Anti-C2orf42
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 54980
UniProt: Q9NWW7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KVEVESIAETYGRIEKQPVLRPLELKTFLKVGNTSPDQKEPTPFIIEWIPDILPQSKIGELRIKFEYGHHRNGHVAEYQDQRPPLDQPLELAPLT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: C2orf42
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-C2orf42 antibody. Corresponding C2orf42 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA031841
HPA031841
HPA031841