Anti-ZC3H12A

Artikelnummer: ATA-HPA032053
Artikelname: Anti-ZC3H12A
Artikelnummer: ATA-HPA032053
Hersteller Artikelnummer: HPA032053
Alternativnummer: ATA-HPA032053-100,ATA-HPA032053-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ23231, MCPIP1
zinc finger CCCH-type containing 12A
Anti-ZC3H12A
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 80149
UniProt: Q5D1E8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ZC3H12A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytoplasmic bodies.
Immunohistochemical staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and ZC3H12A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410904).
HPA032053-100ul
HPA032053-100ul
HPA032053-100ul