Anti-SF3A3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA032055
Artikelname: Anti-SF3A3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA032055
Hersteller Artikelnummer: HPA032055
Alternativnummer: ATA-HPA032055-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PRP9, PRPF9, SAP61, SF3a60
splicing factor 3a, subunit 3, 60kDa
Anti-SF3A3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10946
UniProt: Q12874
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SF3A3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SF3A3 antibody. Corresponding SF3A3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA032055
HPA032055
HPA032055