Anti-KIF17 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA032085
Artikelname: Anti-KIF17 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA032085
Hersteller Artikelnummer: HPA032085
Alternativnummer: ATA-HPA032085-100,ATA-HPA032085-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1405, KIF17B, KIF3X, KLP-2, OSM-3
kinesin family member 17
Anti-KIF17
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 57576
UniProt: Q9P2E2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIF17
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-KIF17 antibody. Corresponding KIF17 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA032085
HPA032085
HPA032085