Anti-OSBPL6 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA032131
Artikelname: Anti-OSBPL6 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA032131
Hersteller Artikelnummer: HPA032131
Alternativnummer: ATA-HPA032131-100,ATA-HPA032131-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ORP6
oxysterol binding protein-like 6
Anti-OSBPL6
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 114880
UniProt: Q9BZF3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NEIVRSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: OSBPL6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line RH-30 shows localization to plasma membrane.
Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using Anti-OSBPL6 antibody. Corresponding OSBPL6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA032131
HPA032131
HPA032131