Anti-FABP2

Artikelnummer: ATA-HPA034607
Artikelname: Anti-FABP2
Artikelnummer: ATA-HPA034607
Hersteller Artikelnummer: HPA034607
Alternativnummer: ATA-HPA034607-100,ATA-HPA034607-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: I-FABP
fatty acid binding protein 2, intestinal
Anti-FABP2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 2169
UniProt: P12104
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FABP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-FABP2 antibody. Corresponding FABP2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and FABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424906).
HPA034607-100ul
HPA034607-100ul
HPA034607-100ul