Anti-HS6ST2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA034625
Artikelname: Anti-HS6ST2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA034625
Hersteller Artikelnummer: HPA034625
Alternativnummer: ATA-HPA034625-100,ATA-HPA034625-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HS6ST2
heparan sulfate 6-O-sulfotransferase 2
Anti-HS6ST2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 90161
UniProt: Q96MM7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.