Anti-SYCP2L

Artikelnummer: ATA-HPA034679
Artikelname: Anti-SYCP2L
Artikelnummer: ATA-HPA034679
Hersteller Artikelnummer: HPA034679
Alternativnummer: ATA-HPA034679-100,ATA-HPA034679-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C6orf177, dJ62D2.1, NO145
synaptonemal complex protein 2-like
Anti-SYCP2L
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 221711
UniProt: Q5T4T6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSMICVIEDFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGMCHLMKDLARTLLTVGDYDQQV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SYCP2L
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
HPA034679-100ul