Anti-TSPYL6 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA034700
Artikelname: Anti-TSPYL6 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA034700
Hersteller Artikelnummer: HPA034700
Alternativnummer: ATA-HPA034700-100,ATA-HPA034700-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TSPYL6
TSPY-like 6
Anti-TSPYL6
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 388951
UniProt: Q8N831
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFPPPRLPEEGVAPQDPADGGHTFHILVDAGRSHGAIKAGQEVTPPP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TSPYL6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-TSPYL6 antibody. Corresponding TSPYL6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA034700
HPA034700
HPA034700