Anti-PRKRA
Artikelnummer:
ATA-HPA034997
- Bilder (7)
| Artikelname: | Anti-PRKRA |
| Artikelnummer: | ATA-HPA034997 |
| Hersteller Artikelnummer: | HPA034997 |
| Alternativnummer: | ATA-HPA034997-100,ATA-HPA034997-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DYT16, HSD14, PACT, RAX |
| protein kinase, interferon-inducible double stranded RNA dependent activator |
| Anti-PRKRA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8575 |
| UniProt: | O75569 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRKRA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PRKRA antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-PRKRA antibody HPA034997 (A) shows similar pattern to independent antibody HPA034996 (B). |
|
|
HPA034997-100ul |
|
|
HPA034997-100ul |
|
|
HPA034997-100ul |
Produktgarantie und fachkundiger Support
