Anti-TBCC

Artikelnummer: ATA-HPA035073
Artikelname: Anti-TBCC
Artikelnummer: ATA-HPA035073
Hersteller Artikelnummer: HPA035073
Alternativnummer: ATA-HPA035073-100,ATA-HPA035073-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CFC
tubulin folding cofactor C
Anti-TBCC
Klonalität: Polyclonal
Konzentration: 0.6 mg/ml
Isotyp: IgG
NCBI: 6903
UniProt: Q15814
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPPAVESIQDS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TBCC
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TBCC antibody. Remaining relative intensity is presented.
Western blot analysis using Anti-TBCC antibody HPA035073 (A) shows similar pattern to independent antibody HPA035074 (B).
HPA035073-100ul
HPA035073-100ul
HPA035073-100ul