Anti-KIAA0556 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035090
Artikelname: Anti-KIAA0556 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035090
Hersteller Artikelnummer: HPA035090
Alternativnummer: ATA-HPA035090-100,ATA-HPA035090-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0556
KIAA0556
Anti-KIAA0556
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23247
UniProt: O60303
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EPPVDYSDDFELCGDVTLQANNTSEDRPQELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQKDVHGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIAA0556
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-KIAA0556 antibody. Corresponding KIAA0556 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA035090
HPA035090
HPA035090