Anti-KIAA0556

Artikelnummer: ATA-HPA035090
Artikelname: Anti-KIAA0556
Artikelnummer: ATA-HPA035090
Hersteller Artikelnummer: HPA035090
Alternativnummer: ATA-HPA035090-100,ATA-HPA035090-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0556
KIAA0556
Anti-KIAA0556
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23247
UniProt: O60303
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EPPVDYSDDFELCGDVTLQANNTSEDRPQELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQKDVHGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIAA0556
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-KIAA0556 antibody. Corresponding KIAA0556 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA035090-100ul
HPA035090-100ul
HPA035090-100ul