Anti-ARHGAP26
Artikelnummer:
ATA-HPA035107
- Bilder (9)
| Artikelname: | Anti-ARHGAP26 |
| Artikelnummer: | ATA-HPA035107 |
| Hersteller Artikelnummer: | HPA035107 |
| Alternativnummer: | ATA-HPA035107-100,ATA-HPA035107-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GRAF, KIAA0621, OPHN1L, OPHN1L1 |
| Rho GTPase activating protein 26 |
| Anti-ARHGAP26 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23092 |
| UniProt: | Q9UNA1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ARHGAP26 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line A-549. |
|
|
HPA035107-100ul |
|
|
|
|
|
HPA035107-100ul |
|
|
HPA035107-100ul |
Produktgarantie und fachkundiger Support
